PDB entry 1pu7

View 1pu7 on RCSB PDB site
Description: Crystal structure of H.pylori 3-methyladenine DNA glycosylase (MagIII) bound to 3,9-dimethyladenine
Deposited on 2003-06-24, released 2003-10-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pu7a_
  • Chain 'B':
    Domains in SCOP 1.71: d1pu7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pu7A (A:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklelkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pu7A (A:)
    ldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafil
    enddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtre
    wlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqen
    lnsalalyentislaqlyarfhgkivefskqklel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pu7B (B:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklelkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pu7B (B:)
    vldsfeilkalksldllknapawwwpnalkfeallgavltqntkfeavlkslenlknafi
    lenddeinlkkiayiefsklaecvrpsgfynqkakrlidlsgnilkdfqsfenfkqevtr
    ewlldqkgigkesadailcyacakevmvvdkysylflkklgieiedydelqhffekgvqe
    nlnsalalyentislaqlyarfhgkivefskqklel