PDB entry 1pu3

View 1pu3 on RCSB PDB site
Description: The Solution NMR Structure and Dynamics of a Recombinant Onconase with Altered N-terminal and Met23 residues
Class: hydrolase
Keywords: bowl-shaped folding of the two sheets, HYDROLASE
Deposited on 2003-06-24, released 2004-03-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: P-30 protein
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (1-104)
    • cloning artifact (0)
    • engineered (23)
  Domains in SCOPe 2.03: d1pu3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pu3A (A:)
  mqdwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvlt
  tsefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc