PDB entry 1pu1

View 1pu1 on RCSB PDB site
Description: Solution structure of the Hypothetical protein mth677 from Methanothermobacter Thermautotrophicus
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, alpha and beta protein (a+b), UNKNOWN FUNCTION
Deposited on 2003-06-23, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein MTH677
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Gene: mth677
  Database cross-references and differences (RAF-indexed):
  • Uniprot O26773 (3-93)
  Domains in SCOPe 2.08: d1pu1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1pu1A (A:)
  gshmslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdelkvdisae
  lyldelsdadpgivdeavdaayrslesfldgfre
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1pu1A (A:)
  mslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdelkvdisaelyl
  delsdadpgivdeavdaayrslesfldgfre