PDB entry 1ptx

View 1ptx on RCSB PDB site
Description: crystal structure of toxin II from the scorpion androctonus australis hector refined at 1.3 angstroms resolution
Class: toxin
Keywords: toxin
Deposited on 1994-09-02, released 1995-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.148
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: scorpion toxin II
  Species: Androctonus australis [TaxId:6858]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01484 (0-63)
  Domains in SCOPe 2.01: d1ptxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ptxA (A:)
  vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
  grch