PDB entry 1pts

View 1pts on RCSB PDB site
Description: crystal structure and ligand binding studies of a screened peptide complexed with streptavidin
Class: biotin-binding protein/peptide
Keywords: GLYCOPROTEIN, BIOTIN-BINDING PROTEIN-PEPTIDE complex
Deposited on 1992-07-23, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptsa_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ptsb_
  • Chain 'P':
    Compound: peptide (fshpqnt)
    Database cross-references and differences (RAF-indexed):
    • PDB 1PTS
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ptsA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptsA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapagsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ptsB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptsB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyessryvltgrydsapasgtalgwtvawkn
    nyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    

  • Chain 'P':
    No sequence available.