PDB entry 1ptr

View 1ptr on RCSB PDB site
Description: protein kinase c delta cys2 domain complexed with phorbol-13-acetate
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1995-05-11, released 1995-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c delta type
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ptra_
  • Heterogens: ZN, PRB

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptrA (A:)
    hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc