PDB entry 1ptr

View 1ptr on RCSB PDB site
Description: protein kinase c delta cys2 domain complexed with phorbol-13-acetate
Deposited on 1995-05-11, released 1995-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ptr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptr_ (-)
    hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc