PDB entry 1ptj

View 1ptj on RCSB PDB site
Description: crystal structure analysis of the di and diii complex of transhydrogenase with a thio-nicotinamide nucleotide analogue
Deposited on 2003-06-23, released 2003-10-07
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.234
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ptjA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptjA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvdaggyakemgeefrkkqae
    avlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgki
    vvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvt
    rd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ptjB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptjB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamefrkkqaeavlkel
    vktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgv
    kivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaiv
    hpaltg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptjC (C:)
    svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn