PDB entry 1ptg

View 1ptg on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c in complex with myo-inositol
Deposited on 1995-05-24, released 1996-07-11
The last revision prior to the SCOP 1.71 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1ptg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ptg_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ptg_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli