PDB entry 1ptf

View 1ptf on RCSB PDB site
Description: the 1.6 angstroms structure of histidine-containing phosphotransfer protein hpr from streptococcus faecalis
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-10-04, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.156
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ptfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ptfA (A:)
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkeglae

    Sequence, based on observed residues (ATOM records): (download) 
    >1ptfA (A:)
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla