PDB entry 1ptd

View 1ptd on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c
Deposited on 1995-05-24, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ptd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ptd_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli