PDB entry 1pt9

View 1pt9 on RCSB PDB site
Description: Crystal Structure Analysis of the DIII Component of Transhydrogenase with a Thio-Nicotinamide Nucleotide Analogue
Class: oxidoreductase
Keywords: Transhydrogenase, thio-nicotinamide, mitochondria, proton translocation, OXIDOREDUCTASE
Deposited on 2003-06-23, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pt9a_
  • Chain 'B':
    Compound: NAD(P) transhydrogenase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pt9b_
  • Heterogens: SO4, TAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pt9A (A:)
    mnrslanvilggygttstaggkpmeisgthteinldnaidmireansiiitpgyglcaak
    aqypiadlvkmlteqgkkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpd
    tdlvlvigandtvnsaaqedpnsiiagmpvlevwkskqvivmkrslgvgyaavdnpifyk
    pntamllgdakktcdalqakvresyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt9A (A:)
    pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
    ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
    siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
    es
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pt9B (B:)
    mnrslanvilggygttstaggkpmeisgthteinldnaidmireansiiitpgyglcaak
    aqypiadlvkmlteqgkkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpd
    tdlvlvigandtvnsaaqedpnsiiagmpvlevwkskqvivmkrslgvgyaavdnpifyk
    pntamllgdakktcdalqakvresyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt9B (B:)
    pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
    ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
    siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
    es