PDB entry 1pt8

View 1pt8 on RCSB PDB site
Description: Crystal structure of the yfdW gene product of E. coli, in complex with oxalate and acetyl-CoA
Class: structural genomics,unknown function
Keywords: CoA transferase, oxalate, acetyl-CoA, E. coli, Structural Genomics, STRUCTURAL GENOMICS,UNKNOWN FUNCTION
Deposited on 2003-06-23, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfdW
    Species: , [TaxId:562,623]
    Gene: YFDW OR B2374 OR SF2441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pt8a_
  • Chain 'B':
    Compound: Hypothetical protein yfdW
    Species: , [TaxId:562,623]
    Gene: YFDW OR B2374 OR SF2441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pt8b_
  • Heterogens: OXL, ACO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pt8A (A:)
    syyhhhhhhlestslykkaglmstplqgikvldftgvqsgpsctqmlawfgadvikierp
    gvgdvtrhqlrdipdidalyftmlnsnkrsielntktaegkevmeklireadilvenfhp
    gaidhmgftwehiqeinprlifgsikgfdecspyvnvkayenvaqaaggaasttgfwdgp
    plvsaaalgdsntgmhlligllaallhrektgrgqrvtmsmqdavlnlcrvklrdqqrld
    klgyleeypqypngtfgdavprggnaggggqpgwilkckgwetdpnayiyftiqeqnwen
    tckaigkpewitdpaystaharqphifdifaeiekytvtidkheavayltqfdipcapvl
    smkeisldpslrqsgsvveveqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqe
    lgysddeiaamkqnhai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt8A (A:)
    mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
    tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
    fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
    laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
    rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
    rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
    qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pt8B (B:)
    syyhhhhhhlestslykkaglmstplqgikvldftgvqsgpsctqmlawfgadvikierp
    gvgdvtrhqlrdipdidalyftmlnsnkrsielntktaegkevmeklireadilvenfhp
    gaidhmgftwehiqeinprlifgsikgfdecspyvnvkayenvaqaaggaasttgfwdgp
    plvsaaalgdsntgmhlligllaallhrektgrgqrvtmsmqdavlnlcrvklrdqqrld
    klgyleeypqypngtfgdavprggnaggggqpgwilkckgwetdpnayiyftiqeqnwen
    tckaigkpewitdpaystaharqphifdifaeiekytvtidkheavayltqfdipcapvl
    smkeisldpslrqsgsvveveqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqe
    lgysddeiaamkqnhai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt8B (B:)
    stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
    mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
    gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
    aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
    ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
    qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
    plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai