PDB entry 1pt6

View 1pt6 on RCSB PDB site
Description:
Deposited on 2003-06-23, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1pt6a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1pt6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pt6A (A:)
    gsecstqldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefn
    lnkyssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdge
    shdnhrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvs
    delalvtivktlgerifaleatavdssgrivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt6A (A:)
    qldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkyss
    teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
    lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelalv
    tivktlgerifa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pt6B (B:)
    gsecstqldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefn
    lnkyssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdge
    shdnhrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvs
    delalvtivktlgerifaleatavdssgrivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt6B (B:)
    ldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkysst
    eevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhrl
    kkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelalvt
    ivktlgerifaleat