PDB entry 1pt3

View 1pt3 on RCSB PDB site
Description: Crystal structures of nuclease-ColE7 complexed with octamer DNA
Class: Hydrolase/DNA
Keywords: HNH MOTIF, ENDONUCLEASE, COLICIN, PROTEIN-DNA COMPLEX, Hydrolase-DNA COMPLEX
Deposited on 2003-06-22, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: COLE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pt3a_
  • Chain 'B':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: COLE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pt3b_
  • Chain 'C':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-gcgatcgc-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pt3A (A:)
    kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
    lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr
    hidihrgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pt3B (B:)
    kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
    lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr
    hidihrgk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.