PDB entry 1pt2

View 1pt2 on RCSB PDB site
Description: crystal structure of levansucrase (e342a) complexed with sucrose
Deposited on 2003-06-22, released 2003-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pt2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pt2A (A:)
    asmketnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwd
    swplqnadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkds
    dkfdandsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdssl
    ningvedyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantg
    tedgyqgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkk
    vmkpliasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltg
    pykplnktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfaps
    fllnikgkktsvvkdsileqgqltvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt2A (A:)
    qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
    dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
    silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
    yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
    eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
    sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
    tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
    kktsvvkdsileqgqltvnk