PDB entry 1pt2

View 1pt2 on RCSB PDB site
Description: Crystal structure of levansucrase (E342A) complexed with sucrose
Class: transferase
Keywords: glycoside hydrolase, levansucrase, beta-propeller, levan, sucrose, transferase
Deposited on 2003-06-22, released 2003-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Levansucrase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: sacB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05655 (Start-446)
      • engineered (315)
    Domains in SCOPe 2.07: d1pt2a_
  • Heterogens: SUC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pt2A (A:)
    asmketnqkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwd
    swplqnadgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkds
    dkfdandsilkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdssl
    ningvedyksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantg
    tedgyqgeeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkk
    vmkpliasntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltg
    pykplnktglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfaps
    fllnikgkktsvvkdsileqgqltvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pt2A (A:)
    qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
    dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
    silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
    yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
    eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
    sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
    tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
    kktsvvkdsileqgqltvnk