PDB entry 1psy

View 1psy on RCSB PDB site
Description: STRUCTURE OF RicC3, NMR, 20 STRUCTURES
Class: plant protein
Keywords: ricc3, albumin seed protein, seed storage protein, plant protein
Deposited on 2003-06-22, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2S albumin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01089 (0-124)
      • conflict (0)
      • conflict (2-3)
    Domains in SCOPe 2.07: d1psya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psyA (A:)
    aefmeskgeregsssqqcrqevqrkdlsscerylrqsssrrstgeevlrmpgdenqqqes
    qqlqqccnqvkqvrdecqceaikyiaedqiqqgqlhgeeservaqrageivsscgvrcmr
    qtrtn