PDB entry 1psu

View 1psu on RCSB PDB site
Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon
Deposited on 2003-06-21, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1psua_
  • Chain 'B':
    Domains in SCOP 1.65: d1psub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1psuA (A:)
    mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
    dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
    tvalfrgkshriggtitgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1psuA (A:)
    mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
    dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
    tvalfrgkshr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1psuB (B:)
    mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
    dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
    tvalfrgkshriggtitgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1psuB (B:)
    mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
    dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
    tvalfrgkshriggtit