PDB entry 1psr

View 1psr on RCSB PDB site
Description: human psoriasin (s100a7)
Class: ef-hand protein
Keywords: ef-hand protein, mad phasing, psoriasis, s100 protein family
Deposited on 1997-11-27, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.109
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psoriasin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1psra_
  • Chain 'B':
    Compound: psoriasin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1psrb_
  • Heterogens: HO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1psrA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1psrB (B:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq