PDB entry 1psq

View 1psq on RCSB PDB site
Description: Structure of a probable thiol peroxidase from Streptococcus pneumoniae
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, THIOL, PEROXIDASE, NYSGXRC, T817, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, oxidoreductase
Deposited on 2003-06-21, released 2003-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable thiol peroxidase
  Species: Streptococcus pneumoniae [TaxId:1313]
  Gene: TPX
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4M5 (0-162)
    • modified residue (0)
    • modified residue (81)
    • modified residue (101)
  Domains in SCOPe 2.08: d1psqa_
• Chain 'B':
  Compound: Probable thiol peroxidase
  Species: Streptococcus pneumoniae [TaxId:1313]
  Gene: TPX
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4M5 (0-162)
    • modified residue (0)
    • modified residue (81)
    • modified residue (101)
  Domains in SCOPe 2.08: d1psqb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1psqA (A:)
  mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
  qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
  ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1psqB (B:)
  mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
  qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
  ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal