PDB entry 1psk

View 1psk on RCSB PDB site
Description: the crystal structure of an fab fragment that binds to the melanoma-associated gd2 ganglioside
Class: immunoglobulin
Keywords: fab, gd2-ganglioside, carbohydrate, melanoma, immunoglobulin
Deposited on 1997-03-03, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA72329 (0-208)
      • conflict (13)
      • conflict (23)
      • conflict (27)
      • conflict (30)
      • conflict (32)
      • conflict (34)
      • conflict (49)
      • conflict (51-53)
      • conflict (56)
      • conflict (58)
      • conflict (61)
      • conflict (66)
      • conflict (69)
      • conflict (72-73)
      • conflict (76)
      • conflict (81-83)
      • conflict (96-98)
      • conflict (100)
      • conflict (135)
    Domains in SCOPe 2.07: d1pskh1, d1pskh2
  • Chain 'L':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pskl1, d1pskl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pskH (H:)
    evqlqqsgpelvkpgasvkiscktsgytftkytmhwvkqshgkslewigdinpnnggtny
    nqkfkgtatltvhkssttaymelrsltsedsavyyctsksfdywgqgttltvssakttap
    svyplapvcgdttgsavtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pskH (H:)
    evqlqqsgpelvkpgasvkiscktsgytftkytmhwvkqshgkslewigdinpnnggtny
    nqkfkgtatltvhkssttaymelrsltsedsavyyctsksfdywgqgttltvssakttap
    svyplapvavtlgclvkgyfpepvtltwnssgvhtfpavlqsdlytlsssvtvtsstwps
    qsitcnvahpasstkvdk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pskL (L:)
    qivltqspaimsaspgekvtitcsasssvsnihwfqqkpgtfpklwiyststlasgvpgr
    fsgsgsgtsysltisrmgaedaatyycqqrsgypftfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec