PDB entry 1psj

View 1psj on RCSB PDB site
Description: acidic phospholipase a2 from agkistrodon halys pallas
Deposited on 1995-05-24, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1psj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1psj_ (-)
sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee
sepc