PDB entry 1psj

View 1psj on RCSB PDB site
Description: acidic phospholipase a2 from agkistrodon halys pallas
Class: hydrolase
Keywords: hydrolase, lipid degradation, calcium
Deposited on 1995-05-24, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1psja_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psjA (A:)
    sliqfetlimkvakksgmfwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
    mdvysfseengdivcggddpckkeicecdraaaicfrdnltlyndkkywafgakncpqee
    sepc