PDB entry 1psd

View 1psd on RCSB PDB site
Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase
Deposited on 1995-05-02, released 1995-07-31
The last revision prior to the SCOP 1.63 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.177
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psdA (A:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    palcdalaskhlagaaidvfptepatnsdpftsplcefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psdB (B:)
    ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
    edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsntrsvaelvigelllllrg
    vpeanakahrgvwnklaagsfeargkklgiigyghigtqlgilaeslgmyvyfydienkl
    plgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeislmkpgsllinasrgtvvdi
    palcdalaskhlagaaidvfptepatnsdpftsplcefdnvlltphiggstqeaqenigl
    evagklikysdngstlsavnfpevslplhggrrlmhihenrpgvltalnkifaeqgvnia
    aqylqtsaqmgyvvidieadedvaekalqamkaipgtirarlly