PDB entry 1psb

View 1psb on RCSB PDB site
Description: Solution structure of calcium loaded S100B complexed to a peptide from N-Terminal regulatory domain of NDR kinase.
Class: metal binding protein
Keywords: helix-loop-helix, protein-peptide complex, metal binding protein
Deposited on 2003-06-21, released 2003-12-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: S-100 protein, beta chain
  Species: Bos taurus [TaxId:9913]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02638 (0-90)
  Domains in SCOPe 2.05: d1psba_
• Chain 'B':
  Compound: S-100 protein, beta chain
  Species: Bos taurus [TaxId:9913]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02638 (0-90)
  Domains in SCOPe 2.05: d1psbb_
• Chain 'C':
  Compound: Ndr Ser/Thr kinase-like protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15208 (0-25)
• Chain 'D':
  Compound: Ndr Ser/Thr kinase-like protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15208 (0-25)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1psbA (A:)
  selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
  dsdgdgecdfqefmafvamittacheffehe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1psbB (B:)
  selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
  dsdgdgecdfqefmafvamittacheffehe
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.