PDB entry 1psb
View 1psb on RCSB PDB site
Description: Solution structure of calcium loaded S100B complexed to a peptide from N-Terminal regulatory domain of NDR kinase.
Class: metal binding protein
Keywords: helix-loop-helix, protein-peptide complex, metal binding protein
Deposited on
2003-06-21, released
2003-12-16
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S-100 protein, beta chain
Species: Bos taurus [TaxId:9913]
Gene: S100B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1psba_ - Chain 'B':
Compound: S-100 protein, beta chain
Species: Bos taurus [TaxId:9913]
Gene: S100B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1psbb_ - Chain 'C':
Compound: Ndr Ser/Thr kinase-like protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Ndr Ser/Thr kinase-like protein
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1psbA (A:)
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1psbB (B:)
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheffehe
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.