PDB entry 1psb

View 1psb on RCSB PDB site
Description: solution structure of calcium loaded s100b complexed to a peptide from n-terminal regulatory domain of ndr kinase.
Deposited on 2003-06-21, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1psba_
  • Chain 'B':
    Domains in SCOP 1.67: d1psbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psbA (A:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psbB (B:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheffehe