PDB entry 1psb

View 1psb on RCSB PDB site
Description: Solution structure of calcium loaded S100B complexed to a peptide from N-Terminal regulatory domain of NDR kinase.
Class: metal binding protein
Keywords: helix-loop-helix, protein-peptide complex, metal binding protein
Deposited on 2003-06-21, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, beta chain
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1psba_
  • Chain 'B':
    Compound: S-100 protein, beta chain
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1psbb_
  • Chain 'C':
    Compound: Ndr Ser/Thr kinase-like protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ndr Ser/Thr kinase-like protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psbA (A:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psbB (B:)
    selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dsdgdgecdfqefmafvamittacheffehe
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.