PDB entry 1psa

View 1psa on RCSB PDB site
Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor
Class: HYDROLASE/hydrolase inhibitor
Keywords: ACID PROTEINASE, HYDROLASE-hydrolase inhibitor complex
Deposited on 1991-10-22, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.139
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsin a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1psaa_
  • Chain 'B':
    Compound: pepsin a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1psab_
  • Heterogens: 0ZL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psaA (A:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psaB (B:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva