PDB entry 1psa

View 1psa on RCSB PDB site
Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor
Deposited on 1991-10-22, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.139
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1psaa_
  • Chain 'B':
    Domains in SCOP 1.55: d1psab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psaA (A:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1psaB (B:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva