PDB entry 1ps9

View 1ps9 on RCSB PDB site
Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase
Deposited on 2003-06-20, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ps9A (A:)
    sypslfapldlgfttlknrvlmgsmhtgleeypdgaerlaafyaerarhgvalivsggia
    pdltgvgmeggamlndasqiphhrtiteavhqeggkialqilhtgrysyqphlvapsalq
    apinrfvphelsheeilqlidnfarcaqlareagydgvevmgsegylinefltlrtnqrs
    dqwggdyrnrmrfavevvravrervgndfiiiyrlsmldlvedggtfaetvelaqaieaa
    gatiintgigwheariptiatpvprgafswvtrklkghvslplvttnrindpqvaddils
    rgdadmvsmarpfladaellskaqsgradeintcigcnqacldqifvgkvtsclvnprac
    hetkmpilpavqkknlavvgagpaglafainaaarghqvtlfdahseiggqfniakqipg
    keefyetlryyrrmievtgvtlklnhtvtadqlqafdetilasgivprtppidgidhpkv
    lsyldvlrdkapvgnkvaiigcggigfdtamylsqpgestsqniagfcnewgidsslqqa
    gglspqgmqiprsprqivmlqrkaskpgqglgkttgwihrttllsrgvkmipgvsyqkid
    ddglhvvingetqvlavdnvvicagqepnralaqplidsgktvhliggcdvameldarra
    iaqgtrlalei