PDB entry 1ps0

View 1ps0 on RCSB PDB site
Description: Crystal Structure of the NADP(H)-Dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: adh topology, nadp(h)dependent, oxidoreductase
Deposited on 2003-06-20, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.264
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR318C (ADH6)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ps0a1, d1ps0a2
  • Heterogens: ZN, NAP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ps0A (A:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd