PDB entry 1ps0

View 1ps0 on RCSB PDB site
Description: Crystal Structure of the NADP(H)-Dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
Deposited on 2003-06-20, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.264
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ps0A (A:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd