PDB entry 1prv

View 1prv on RCSB PDB site
Description: purine repressor dna-binding domain dna binding
Deposited on 1995-05-08, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1prv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prv_ (-)
    matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv