PDB entry 1pru

View 1pru on RCSB PDB site
Description: purine repressor DNA-binding domain DNA binding
Class: DNA-binding protein
Keywords: purine repressor, DNA-binding protein
Deposited on 1995-05-08, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1prua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pruA (A:)
    matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv