PDB entry 1prr

View 1prr on RCSB PDB site
Description: nmr-derived three-dimensional solution structure of protein s complexed with calcium
Deposited on 1994-03-25, released 1994-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1prr_ (-)
manitvfynedfqgkqvdlppgnytraqlaalgienntissvkvppgvkailyqndgfag
dqievvanaeelgplnnnvssirvisvpvqprarffykeqfdgkevdlppgqytqaeler
ygidnntissvkpqglavvlfkndnfsgdtlpvnsdaptlgamnnntssiris