PDB entry 1prq

View 1prq on RCSB PDB site
Description: acanthamoeba castellanii profilin ia
Class: contractile protein
Keywords: actin-binding protein, contractile protein
Deposited on 1997-08-18, released 1997-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.141
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: profilin ia
  Species: Acanthamoeba castellanii [TaxId:5755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68696 (0-124)
  Domains in SCOPe 2.06: d1prqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1prqA (A:)
  swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgqtlasafnnadpirasgf
  dlagvhyvtlraddrsiygkkgsagvitvktsksilvgvynekiqpgtaanvvekladyl
  igqgf