PDB entry 1prg

View 1prg on RCSB PDB site
Description: ligand binding domain of the human peroxisome proliferator activated receptor gamma
Class: gene regulation
Keywords: thiazolidinedione, ligand-binding domain, nuclear receptor, apo, transcription factor, orphan receptor, gene regulation
Deposited on 1998-07-02, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PPAR GAMMA CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prga_
  • Chain 'B':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PPAR GAMMA CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1prgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl