PDB entry 1pre

View 1pre on RCSB PDB site
Description: proaerolysin
Deposited on 1995-09-15, released 1996-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.208
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1preA (A:)
    epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
    ngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsylah
    ylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynldp
    dsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvtt
    knkfkwplvgetelsieiaanqswasqnggstttslsqsvrptvparskipvkielykad
    isypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwdk
    ryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapvp
    laadskvrrarsvdgagqglrleipldaqelsglgfnnvslsvtpaanq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1preA (A:)
    epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
    ngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsylah
    ylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynldp
    dsfkhgdvtqsdrqlvktvvgwavndpqsgydvtlrydtatnwsktntyglsekvttknk
    fkwplvgetelsieiaanqswasqnggstttslsqsvrptvparskipvkielykadisy
    pyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwdkryi
    pgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapvplgl
    rleipldaqelsglgfnnvslsvtpaanq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1preB (B:)
    epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
    ngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsylah
    ylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynldp
    dsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvtt
    knkfkwplvgetelsieiaanqswasqnggstttslsqsvrptvparskipvkielykad
    isypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwdk
    ryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapvp
    laadskvrrarsvdgagqglrleipldaqelsglgfnnvslsvtpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1preB (B:)
    epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
    ngeikpgtasntwcyptnpvtgeiptlsaldipdgdevdvqwrlvhdsanfikptsylah
    ylgyawvggnhsqyvgedmdvtrdgdgwvirgnndggcdgyrcgdktaikvsnfaynldp
    dsfkhgdvtqsdrqlvktvvgwavndsdtpqsgydvtlrydtatnwsktntyglsekvtt
    knkfkwplvgetelsieiaanqswasqnggstttslsqsvrptvparskipvkielykad
    isypyefkadvsydltlsgflrwggnawythpdnrpnwnhtfvigpykdkassiryqwdk
    ryipgevkwwdwnwtiqqnglstmqnnlarvlrpvragitgdfsaesqfagnieigapvp
    laalrleipldaqelsglgfnnvslsvtpaa