PDB entry 1prb

View 1prb on RCSB PDB site
Description: structure of an albumin-binding domain, nmr, minimized average structure
Deposited on 1997-01-15, released 1997-07-23
The last revision prior to the SCOP 1.69 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1prb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1prb_ (-)
    tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha