PDB entry 1pr9

View 1pr9 on RCSB PDB site
Description: Human L-Xylulose Reductase Holoenzyme
Class: oxidoreductase
Keywords: short chain dehydrogenase/reductase, dinucleotide binding domain, OXIDOREDUCTASE
Deposited on 2003-06-20, released 2004-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pr9a_
  • Chain 'B':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pr9b_
  • Heterogens: K, NAP, 2HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pr9A (A:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pr9B (B:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac