PDB entry 1pr7

View 1pr7 on RCSB PDB site
Description: renin complexed with compound ib
Deposited on 2003-06-20, released 2003-07-08
Made obsolete on 2003-08-18

The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.214
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.73: d1pr7a_
  • Chain 'B':
    Domains in SCOP 1.73: d1pr7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pr7A (A:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr7A (A:)
    nttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklf
    dasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaef
    dgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpq
    hyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklme
    algakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamd
    ippptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pr7B (B:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr7B (B:)
    ttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfd
    asdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefd
    gvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpqh
    yegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmea
    lgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdi
    ppptgptwalgatfirkfytefdrrnnrigfalar