PDB entry 1pr3

View 1pr3 on RCSB PDB site
Description: Crystal Structure of the R103K Mutant of Aspartate Semialdehyde dehydrogenase from Haemophilus influenzae
Class: oxidoreductase
Keywords: aspartate semialdehyde dehydrogenase, enzyme, phosphate, OXIDOREDUCTASE
Deposited on 2003-06-19, released 2004-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.225
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • engineered (102)
    Domains in SCOPe 2.06: d1pr3a1, d1pr3a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pr3A (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalkmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr3A (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
    ggdytnevypklkatgwdgywvdaasalkmkddaiivldpvnqhviseglkkgiktfvgg
    nctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdp
    assildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnki
    lglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkei
    tlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva