PDB entry 1pr2

View 1pr2 on RCSB PDB site
Description: Escherichia coli Purine Nucleoside Phosphorylase Complexed with 9-beta-D-[2-deoxyribofuranosyl]-6-methylpurine and Phosphate/Sulfate
Deposited on 2003-06-19, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.173
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pr2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1pr2b_
  • Chain 'C':
    Domains in SCOP 1.67: d1pr2c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pr2A (A:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr2A (A:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pr2B (B:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr2B (B:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pr2C (C:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr2C (C:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk