PDB entry 1pr1

View 1pr1 on RCSB PDB site
Description: escherichia coli purine nucleoside phosphorylase complexed with formycin b and phosphate/sulfate
Deposited on 2003-06-19, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pr1a_
  • Chain 'B':
    Domains in SCOP 1.67: d1pr1b_
  • Chain 'C':
    Domains in SCOP 1.67: d1pr1c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pr1A (A:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr1A (A:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhrqttfndmikialesvllgdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pr1B (B:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr1B (B:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pr1C (C:)
    matphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisv
    mghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrir
    fkdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgve
    meaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pr1C (C:)
    atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
    ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
    kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
    eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk