PDB entry 1pqz

View 1pqz on RCSB PDB site
Description: murine cytomegalovirus immunomodulatory protein m144
Class: Viral protein/Immune system
Keywords: Virus, immune evasion, MCMV, MHC, IG domain, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Viral protein/Immune system COMPLEX
Deposited on 2003-06-19, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mcmv m144
    Species: Murid herpesvirus 1 [TaxId:10366]
    Gene: m144
    Database cross-references and differences (RAF-indexed):
    • PDB 1PQZ (0-237)
    Domains in SCOPe 2.07: d1pqza1, d1pqza2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pqzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pqzA (A:)
gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke
fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera
rdcqkklteyrklvlasavspqleverrssgreggmrlrcfardyypadleirwwkddgg
ggalpqtskqhhdplpsgqglyqkhidvyvdgglehvyscrvkgiatglelqivrwkg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pqzB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm