PDB entry 1pqz

View 1pqz on RCSB PDB site
Description: murine cytomegalovirus immunomodulatory protein m144
Deposited on 2003-06-19, released 2004-07-06
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.245
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pqzA (A:)
    gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke
    fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera
    rdcqkklteyrklvlasavspqleverrssgreggmrlrcfardyypadleirwwkddgg
    ggalpqtskqhhdplpsgqglyqkhidvyvdgglehvyscrvkgiatglelqivrwkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pqzB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm