PDB entry 1pqx

View 1pqx on RCSB PDB site
Description: Solution NMR Structure of Staphylococcus aureus protein SAV1430. Northeast Strucutral Genomics Consortium Target ZR18.
Class: Structural genomics, unknown function
Keywords: ZR18,NMR structure, AUTOSTRUCTURE,SPINS,AUTOASSIGN, Northeast Structural Genomics Consortium, Structural genomics, Protein Structure Initiative, PSI, NESG, unknown function
Deposited on 2003-06-19, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein
  Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
  Gene: SAV1430
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99U58 (0-82)
    • expression tag (83-90)
  Domains in SCOPe 2.07: d1pqxa1, d1pqxa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pqxA (A:)
  mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
  isvdkendanwetvlpkveavfelehhhhhh