PDB entry 1pqx

View 1pqx on RCSB PDB site
Description: solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics consortium target zr18.
Deposited on 2003-06-19, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1pqxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pqxA (A:)
  mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdf
  isvdkendanwetvlpkveavfelehhhhhh